Membrane Bound TNFα CHO-K1 Cell Line
1
Discover top-quality products tailored for scientific and medical research. Request a personalized quote today
to enhance your projects.
TNFα Amino Acid Sequence (P01375):MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Species | Hamster |
Cat.No | ABC-X0472F |
Quality Control | All cells test negative for mycoplasma, bacteria, yeast, and fungi. |
Product Category | Transfected Stable Cell Lines |
Size/Quantity | 1 vial |
Cell Type | Epithelial |
Shipping Info | Dry Ice |
Growth Conditions | 37 ℃, 5% CO2 |
Source Organ | Ovary |
Disease | Normal |
Biosafety Level | 1 |
Storage | Liquid Nitrogen |
Product Type | Overexpression Stable Cell Lines |
Host Cell | CHO-K1 |
When you publish your research, please cite our product as “AcceGen Biotech Cat.# XXX-0000”. In return, we’ll give you a $100 coupon. Simply click here and submit your paper’s PubMed ID (PMID).
For research use only