1
Discover top-quality products tailored for scientific and medical research. Request a personalized quote today
to enhance your projects.
Species | Human |
Cat.No | ABC-X0376F |
Quality Control | All cells test negative for mycoplasma, bacteria, yeast, and fungi. |
Product Category | Transfected Stable Cell Lines |
Size/Quantity | 1 vial |
Cell Type | Epithelial |
Shipping Info | Dry Ice |
Growth Conditions | 37 ℃, 5% CO2 |
Source Organ | Kidney |
Disease | Normal |
Biosafety Level | 1 |
Storage | Liquid Nitrogen |
Product Type | Overexpression Stable Cell Lines |
Host Cell | HEK293 |
A monoclonal cell line stably expressing SSTR2 constructed using viral technology based on HEK-293 cells.
Cynomolgus_SSTR2 Amino Acid Sequence (XP_005584875.2): MDMVDKPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIVGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSSTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI
When you publish your research, please cite our product as “AcceGen Biotech Cat.# XXX-0000”. In return, we’ll give you a $100 coupon. Simply click here and submit your paper’s PubMed ID (PMID).
For research use only